PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00098534001
Common NameGSBRNA2T00098534001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 424aa    MW: 46290.8 Da    PI: 6.9983
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00098534001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-39113172261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  GSBRNA2T00098534001 113 PDKILPCPRCSSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSL 172
                          7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31109170IPR003851Zinc finger, Dof-type
PfamPF027013.9E-32115171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.444117171IPR003851Zinc finger, Dof-type
PROSITE patternPS013610119155IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MSDPAMKLFG KTIPLPELVC VDSSSSYTEH QHQNPVRLSD SCTGDDEEMG DSGLAGDDVW  60
FHGGDSESEK EEKANQCGEE SSNVTMASST KTDEESSSQN NETCSREGKL KKPDKILPCP  120
RCSSMETKFC YYNNYNVNQP RHFCKKCQRY WTAGGTMRNV PVGAGRRKNK SLASHYNRYV  180
GITSAEDMHK AAARTDPNLM TIGSDSVLCE SMASGLSLAE KSMLNTETGL QEEPNEGLKI  240
TVPLKNKETV AISPLPKAPC FAGPPPPPAA WSYPWNGVSW TVLPFYPPPA YWSCPGVSPG  300
TWNSFTWMSQ PISPSGGSGP NSPTLGKHSR DESIAEPGTK RISGRCLWVP KTLRIDDPEE  360
AAKSSIWETL GIKKDEKTDT FRAFRSSHKV KSCLSDGKHP GRRPELLANP AALSRSANFH  420
ESS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00098534001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529391e-86AK352939.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-18-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647756.10.0PREDICTED: cyclic dof factor 2-like
SwissprotQ93ZL50.0CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A078BUR50.0A0A078BUR5_BRANA; BnaA07g14740D protein
STRINGBra028437.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137951825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.20.0cycling DOF factor 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]